PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 473042
Common NameARALYDRAFT_473042
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 321aa    MW: 34851.7 Da    PI: 9.5648
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
473042genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.52.9e-383393262
  zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
            ++ +lkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGg+ rknk+++
  473042 33 PQPQLKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGSYRKNKRVK 93
            67899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.5E-333691IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-273791IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9013791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MPIISSPNTN PLASMQSKNM IVASSHQQQP QQPQPQLKCP RCDSSNTKFC YYNNYSLSQP  60
RHFCKACKRY WTRGGTLRNV PVGGSYRKNK RVKRPSNATA TAASTVSTTT SSSPNNPHQI  120
SHFSSMNHHP LFYGLSDHMS SCNNLPMIPS RFSDSSKTSS TSGLESEFLS SGFSSLSALG  180
LGHPHHMSHD HTINGSFINN STTNKLFLLS GLFGSSMSSS SSSPTLLQHP NKPMNNGGDM  240
LGQSHLQTLA SLQDLHVGGN NEDMKYKEGK LDQISGNING FMSSSSLDPS NYNNMWNNAS  300
VVNGAWLDPT NNIVGSSLTS L
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2992720.0AY299272.1 Arabidopsis thaliana clone D2 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002893522.10.0hypothetical protein ARALYDRAFT_473042, partial
SwissprotQ9FZA41e-166DOF14_ARATH; Dof zinc finger protein DOF1.4
TrEMBLD7KCV20.0D7KCV2_ARALL; Putative uncharacterized protein (Fragment)
STRINGfgenesh2_kg.1__2996__AT1G28310.20.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47092650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.21e-147Dof family protein